PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G091300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 323aa    MW: 35911.7 Da    PI: 6.7815
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G091300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +l +++++ G g+W++ ++  g++R++k+c++rw +yl
  Sevir.4G091300.1.p 14 KGPWTPEEDHKLMNYIQKNGHGSWRALPELAGLNRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding538e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++++E++ +++++  lG++ W++Ia+ ++ gRt++++k++w+++l
  Sevir.4G091300.1.p  67 RGKFSKDEEQTILQLHSILGNK-WSAIAKNLP-GRTDNEIKNFWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.591961IPR017930Myb domain
SuperFamilySSF466891.2E-3011108IPR009057Homeodomain-like
SMARTSM007173.4E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001671.71E-91661No hitNo description
PROSITE profilePS5129426.70262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2765117IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002496.2E-1667112IPR001005SANT/Myb domain
CDDcd001677.68E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRPPCCVEK GLKKGPWTPE EDHKLMNYIQ KNGHGSWRAL PELAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SKDEEQTILQ LHSILGNKWS AIAKNLPGRT DNEIKNFWNT HLRKKLIQMG  120
IDPMTHRPRT DFFAALPQLI ALANLHQLIE QQQWDGQTTM PQTEAVQAAN HQYMQAMLQS  180
AASIAPNPTT VSSLTTDLEQ ISLLNPQHML SPTLLESTGG EDIARQVPHN QPITFFDQPV  240
SNINLSSDNN VSSSEQCLVE GGSSSRKSML LSENSLPPLT DMSASNPCNA ISTLKCGASS  300
TPTLSPSWSE ILLDEELMRE FE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-28121162105C-Myb DNA-Binding Domain
1msf_C1e-28121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966803.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP02e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLK3Y1M00.0K3Y1M0_SETIT; Uncharacterized protein
STRINGSi008086m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-102myb domain protein 93